DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psma6a

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_705941.2 Gene:psma6a / 171585 ZFINID:ZDB-GENE-020326-1 Length:246 Species:Danio rerio


Alignment Length:183 Identity:34/183 - (18%)
Similarity:68/183 - (37%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVG--------DGGDTIQFTDF 61
            |.:.::|.|..::.:.......|:    |.|.:..|  |.:...:|        |....:|...:
Zfish    38 TSVAVRGKDCAVVITQRKVPDKLL----DSSTVTHL--FRITENIGCVMSGMTADSRSQVQRARY 96

  Fly    62 ISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPDLHYI 120
            .:.|   :|..:||.:......    |.:||..:..|:      ....|::.|.|...||.::..
Zfish    97 EAAN---WKYKYGYEIPVDMLC----KRIADISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKC 154

  Fly   121 DSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRL 173
            |..|              .:||.   :...:.:.|.:|.|.::|   :|:::|
Zfish   155 DPAG--------------YYCGF---KATAAGVKQTEATSFLEK---KIKKKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 34/183 (19%)
proteasome_beta_type_2 3..194 CDD:239727 34/183 (19%)
psma6aNP_705941.2 PRK03996 6..239 CDD:235192 34/183 (19%)
proteasome_alpha_type_6 8..220 CDD:239723 34/183 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.