DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R2 and psmb5

DIOPT Version :9

Sequence 1:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:175 Identity:38/175 - (21%)
Similarity:76/175 - (43%) Gaps:17/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLY 69
            |.|..|....|::|.|:..............|:..::.:.:....|...|...:...:::...:|
 Frog    55 TTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY 119

  Fly    70 KISHGYHLSAKSAAHFTRKTLADYIRTNTRYQ-------VAMLLAGYDAVEGPDLHYIDSYGAAQ 127
            ::.:...:|..:|:    |.||:.:     ||       :..::.|:|. .||.|:|:||.|...
 Frog   120 ELRNKERISVAAAS----KLLANMV-----YQYKGMGLSMGTMICGWDK-RGPGLYYVDSEGNRV 174

  Fly   128 SINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRR 172
            |.:....|.|||:...:|.|.:|.::..|:|..|.::.:.:...|
 Frog   175 SGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELARRSIYQATYR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 38/175 (22%)
proteasome_beta_type_2 3..194 CDD:239727 38/175 (22%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.