DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or23a and LOC1279090

DIOPT Version :10

Sequence 1:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_318760.2 Gene:LOC1279090 / 1279090 VectorBaseID:AGAMI1_014175 Length:375 Species:Anopheles gambiae


Alignment Length:42 Identity:14/42 - (33%)
Similarity:21/42 - (50%) Gaps:7/42 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TNTEFIIMVIDSTDRERLAVTREELYKMLQHEDLTKASLLVY 123
            |:|:.|:..:|:..|:    .|..|:.|   .|||..||..|
Mosquito    62 THTKEIVNNMDTMLRD----MRGSLHGM---SDLTLESLQCY 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 14/42 (33%)
LOC1279090XP_318760.2 None

Return to query results.
Submit another query.