DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R1 and PBC2

DIOPT Version :10

Sequence 1:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_565156.1 Gene:PBC2 / 844080 AraportID:AT1G77440 Length:204 Species:Arabidopsis thaliana


Alignment Length:168 Identity:28/168 - (16%)
Similarity:63/168 - (37%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYK 68
            ::.:.|.:...:|||.........:..:.::..:|.|:..:..:|...|.......::....||:
plant    11 VVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQTLYQRLVFRHKLYQ 75

  Fly    69 ITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLG-NSVPVRYGGH 132
            :....|:........:...|  |.|....|....::.|....:.|.:..:|.:| ..:...:...
plant    76 LREERDMKPETFASLVSAIL--YEKRFGPFLCQPVIAGLGDDNKPFICTMDSIGAKELAKDFVVS 138

  Fly   133 GAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKR 170
            |.|........|..:||||:.:..::.|.:.::....|
plant   139 GTASESLYGACEAMFKPDMEAEELFETISQALLSSVDR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R1NP_608698.2 proteasome_beta_type_2 1..193 CDD:239727 28/168 (17%)
PBC2NP_565156.1 proteasome_beta_type_3 6..200 CDD:239728 28/168 (17%)

Return to query results.
Submit another query.