DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R1 and PAA1

DIOPT Version :10

Sequence 1:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198409.1 Gene:PAA1 / 833524 AraportID:AT5G35590 Length:246 Species:Arabidopsis thaliana


Alignment Length:187 Identity:43/187 - (22%)
Similarity:73/187 - (39%) Gaps:33/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEVRKTH--RISDYCMMSTAGDGGDCLKFSDFILRNMD 65
            |.:||:|.|.:.:.:   :.|....|.|:...||  .|:.|..:...|...|.............
plant    38 TSIGVRGKDSVCVVT---QKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAA 99

  Fly    66 LYKITNGYDLTVRGAVHFI-------RRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGN 123
            .::.|.||::.|.....:|       .:|  ||::   ...|..:|.|.|..:||.|:..|..|:
plant   100 EFRFTYGYEMPVDILAKWIADKSQVYTQH--AYMR---PLGVVAMVMGVDEENGPLLYKCDPAGH 159

  Fly   124 SVPVRYGGHGA---------AMNFCTPILEE--FYKPDMDTQAAYDVIKKCVIELYK 169
                 :.||.|         |:||....::|  .:..|...|.|...::..:.|.:|
plant   160 -----FYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETVQTAISALQSVLQEDFK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R1NP_608698.2 proteasome_beta_type_2 1..193 CDD:239727 43/187 (23%)
PAA1NP_198409.1 proteasome_alpha_type_6 8..220 CDD:239723 43/187 (23%)

Return to query results.
Submit another query.