DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R1 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:212 Identity:45/212 - (21%)
Similarity:87/212 - (41%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEVR-KTHRISDYCMMSTAGDGGDCLKFSDFILRNMDL 66
            :|:.:.|.||.::|:|| |..|...:....: |..::|...::.:||...|.|..:..|...|..
  Fly    31 SIVAIAGDDFAVIAADT-RLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQS 94

  Fly    67 YKITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVRYGG 131
            |:.|:...:|.......:  .::.|.:....:.||.::.|.|......::..|.:|:.....|..
  Fly    95 YEHTHLRTMTTEAVAQML--SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRA 157

  Fly   132 HGAAMNFCTPI-----------LEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISK 185
            .|.|.....|:           ||:..|..:..:.|..|.....|...:|.:....::.:.:|:|
  Fly   158 GGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITK 222

  Fly   186 NGITKMNSINLESLRGD 202
            :||    .:...:||.|
  Fly   223 DGI----EVRTLTLRQD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 45/212 (21%)
proteasome_beta_type_2 1..193 CDD:239727 42/201 (21%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 44/210 (21%)
PRE1 24..225 CDD:223711 40/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.