DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta4R1 and pas-3

DIOPT Version :10

Sequence 1:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001379751.1 Gene:pas-3 / 172139 WormBaseID:WBGene00003924 Length:250 Species:Caenorhabditis elegans


Alignment Length:179 Identity:46/179 - (25%)
Similarity:79/179 - (44%) Gaps:33/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TILGVKGTDFIILASDTMRNKSAMWLDDEV--RKTHRISDYCMMSTAGDGGDCLKFSDFILRNM- 64
            |.||:..::.|::|::  |......|||.|  .|.:|:||....:.||...|    ::.::.:: 
 Worm    33 TCLGILSSEGIVVAAE--RKNVHKLLDDSVMTEKVYRLSDNISCTVAGITAD----ANILINHLR 91

  Fly    65 ---DLYKITNGYDLTVRGAVHFIRRHLSAY--LKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNS 124
               ..|:.:.|.::.|...|..:......|  :.....|.||||..|:|...|.:|:..|..|| 
 Worm    92 WWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPFGVSLLYIGWDKHYGYQLYQSDPSGN- 155

  Fly   125 VPVRYGG---------HGAAMNFCTPILEEFYKPDMD--TQAAYDVIKK 162
                |.|         |.||:   |.:.:|:..|:::  .|.|..|:.|
 Worm   156 ----YTGWKATCIGSNHQAAV---TLLKQEYKSPNLEEAKQLAIKVLWK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta4R1NP_608698.2 proteasome_beta_type_2 1..193 CDD:239727 46/179 (26%)
pas-3NP_001379751.1 proteasome_alpha_type_4 3..213 CDD:239721 46/179 (26%)

Return to query results.
Submit another query.