DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and YCK3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_011049.2 Gene:YCK3 / 856860 SGDID:S000000925 Length:524 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:126/335 - (37%)
Similarity:182/335 - (54%) Gaps:63/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLGSGSFGDIYEAKHMGSGLH--------------------VALKVERKNAGQSHLSIESTVYNL 64
            |:|.||||.|:|.:::   ||                    ||:|.|.:::....|..|...|.:
Yeast    19 KIGEGSFGVIFEGENI---LHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRI 80

  Fly    65 LRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHH 129
            |...:|||..|.|.....|::|:::|||||||.||..|.|:||:||..|:|.||:||:..:|.|.
Yeast    81 LNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTCMVAKQMIDRVRAIHDHD 145

  Fly   130 YVHRDIKPENFLMGVGLTRHR----------------------LHLIDFGLSKRYWDMKENRHVP 172
            .::|||||:|||    :::::                      ::::|||::|:|.|.:..:|:|
Yeast   146 LIYRDIKPDNFL----ISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIP 206

  Fly   173 QRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGL-LPNSKLQKAEMILE 236
            .|.....:|||||.|:|....:.|||||||||:|:|..|.|||||||||| .||:|| |.|.|..
Yeast   207 YRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKL-KYEKIGM 270

  Fly   237 MKLSTLPNSLCA--GYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDL----IYD 295
            .|....|:.|..  ..|.:|..|:.|.|.|.|:|:|||..:    :||:.:....|||    .||
Yeast   271 TKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYL----ISLMDDALRLNDLKDDGHYD 331

  Fly   296 WDHAEKNSGK 305
            |  .:.|.||
Yeast   332 W--MDLNGGK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 107/283 (38%)
STKc_CK1 17..279 CDD:270918 115/303 (38%)
YCK3NP_011049.2 PKc_like 13..320 CDD:419665 117/312 (38%)
ROM1 361..>479 CDD:227709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.