DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CKL13

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_171939.1 Gene:CKL13 / 839520 AraportID:AT1G04440 Length:468 Species:Arabidopsis thaliana


Alignment Length:301 Identity:136/301 - (45%)
Similarity:195/301 - (64%) Gaps:3/301 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            |||||||||:|:...::.:|..||:|:|...|....|..||.:|.||:.|.|||....|......
plant    13 RKLGSGSFGEIFLGVNVQTGEEVAVKLEPLRARHPQLHYESKLYMLLQGGTGIPHLKWFGVEGEF 77

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            :.:|::|||||:|..|..|:|.||:||||||||||::|:||:|:..::||||||:|||||:|...
plant    78 NCMVIDLLGPSMEEFFNYCSRSFSLKTVLMLADQMINRVEYMHVKGFLHRDIKPDNFLMGLGRKA 142

  Fly   149 HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLL 213
            :::::||:||:|:|.|::.::|:|.|......|||||||||......|||||||||:||:|:|.|
plant   143 NQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYLLMYFL 207

  Fly   214 RGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCT 278
            |||||||||...:|.||.:.|.|.|..|....||..:|.||.:|.:|.|.|.||::|||..::..
plant   208 RGSLPWQGLRAGTKKQKYDKISEKKRLTPVEVLCKNFPPEFTSYFLYVRSLRFEDKPDYSYLKRL 272

  Fly   279 FLSLLFNLKFTNDLIYDWD---HAEKNSGKSGSEEDRVVVK 316
            |..|.....:..|.::||.   :.:..|..|.:.:.|..::
plant   273 FRDLFIREGYQFDYVFDWTILRYPQFGSSSSSNSKPRPTLR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 120/239 (50%)
STKc_CK1 17..279 CDD:270918 128/259 (49%)
CKL13NP_171939.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 130/268 (49%)
Pkinase 9..241 CDD:278497 114/227 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.