DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and ckl4

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_194615.2 Gene:ckl4 / 829007 AraportID:AT4G28860 Length:414 Species:Arabidopsis thaliana


Alignment Length:305 Identity:144/305 - (47%)
Similarity:184/305 - (60%) Gaps:9/305 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            ||:|.||||:|:.|.|:.:...||:|:|........|..|:.:|..|..|.|||....|..:...
plant    13 RKIGGGSFGEIFLATHIDTFEIVAVKIENSKTKHPQLLYEAKLYRTLEGGSGIPRIRWFGVDGTE 77

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            :.|||:|||||||.||..|.|:||.||||||||||:.|:||:|...|:||||||:|||||:|...
plant    78 NALVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQMLTRIEYVHSKGYLHRDIKPDNFLMGLGRKA 142

  Fly   149 HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLL 213
            ::::||||||:|||.|...|||:|.|......|||||||.|......|.|||||||:||||:|.|
plant   143 NQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGTARYASCNTHLGIEQGRRDDLESLGYVLLYFL 207

  Fly   214 RGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCT 278
            |||||||||....|.||.:.|.|.|:||....||..:|.||.:|..|...|.|::.|||..::..
plant   208 RGSLPWQGLKAVDKKQKYDKICEKKISTPIEVLCKSHPVEFASYFHYCHTLTFDQRPDYGFLKRL 272

  Fly   279 FLSLLFNLKFTNDLIYDW-----DHAEKNSGKS----GSEEDRVV 314
            |..|.....:..|.||||     ..::|...:|    ||...|.:
plant   273 FRDLFSREGYEFDYIYDWTIIKYQQSQKTRSQSQAVPGSSNARAI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 126/239 (53%)
STKc_CK1 17..279 CDD:270918 132/259 (51%)
ckl4NP_194615.2 PKc_like 8..282 CDD:419665 134/268 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.