DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CKL6

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_567812.1 Gene:CKL6 / 828972 AraportID:AT4G28540 Length:479 Species:Arabidopsis thaliana


Alignment Length:297 Identity:137/297 - (46%)
Similarity:190/297 - (63%) Gaps:3/297 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            ||:|.||||:::.|..:.:|...|:|:|........|..||.:|.||:.|.|||....|.....:
plant    17 RKIGGGSFGELFLAVSLQTGEEAAVKLEPAKTKHPQLHYESKIYMLLQGGSGIPSLKWFGVQGDY 81

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            :.:|::|||||||.||..||||.::|.|||||||::.|:||:|...::||||||:|||||:|...
plant    82 NAMVIDLLGPSLEDLFNYCNRRLTLKAVLMLADQLISRVEYMHSRGFLHRDIKPDNFLMGLGRKA 146

  Fly   149 HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLL 213
            :::::|||||:|:|.|::.:||:|.|......|||||||||......|||||||||:||||:|.|
plant   147 NQVYIIDFGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFL 211

  Fly   214 RGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCT 278
            |||||||||...:|.||.:.|.|.|:||....||..||.||.:|..|.|.|.||::|||..::..
plant   212 RGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKSYPPEFVSYFQYCRSLRFEDKPDYSYLKRL 276

  Fly   279 FLSLLFNLKFTNDLIYDW---DHAEKNSGKSGSEEDR 312
            |..|.....:..|.::||   .|.:.::....|..:|
plant   277 FRDLFIREGYQFDYVFDWTALKHPQSSARSHSSTHER 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 121/239 (51%)
STKc_CK1 17..279 CDD:270918 129/259 (50%)
CKL6NP_567812.1 STKc_CK1_delta_epsilon 12..286 CDD:271027 131/268 (49%)
PHA03307 302..>471 CDD:223039 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.