DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CK1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_194340.1 Gene:CK1 / 828716 AraportID:AT4G26100 Length:450 Species:Arabidopsis thaliana


Alignment Length:288 Identity:135/288 - (46%)
Similarity:191/288 - (66%) Gaps:8/288 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NSIMVIRKLGSGSFGDIYEAKHMGSGLH----VALKVERKNAGQSHLSIESTVYNLLRHGMGIPM 73
            |...:.||:||||||:||    :|:.:|    :|:|:|........|..||.:|.:|:.|.|:|.
plant     7 NKFRLGRKIGSGSFGEIY----LGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPN 67

  Fly    74 TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPE 138
            ...|.....::||||:|||||||.||..|:|:.|:|:||||||||::|:|:.|...::|||:||:
plant    68 VKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPD 132

  Fly   139 NFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
            |||||:|...:::::|||||:|:|.|...::|:|.|......|||||||:|......||||||||
plant   133 NFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLE 197

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:||:|:|.|:||||||||...:|.||.|.|.|.|:||...:||.|||:||.:|..|.|.|.|::
plant   198 SLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDD 262

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDW 296
            :|||..::..|..|.....|..|.::||
plant   263 KPDYAYLKRIFRDLFIREGFQFDYVFDW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 121/246 (49%)
STKc_CK1 17..279 CDD:270918 128/265 (48%)
CK1NP_194340.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 130/277 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.