DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CKI1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_193170.1 Gene:CKI1 / 827076 AraportID:AT4G14340 Length:457 Species:Arabidopsis thaliana


Alignment Length:278 Identity:133/278 - (47%)
Similarity:183/278 - (65%) Gaps:0/278 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            |||||||||::|...::.:|..||:|:|........|..||.:|..|:.|.|:|....|.....:
plant    19 RKLGSGSFGELYLGINIQTGEEVAVKLEPVKTRHPQLQYESKIYMFLQGGTGVPHLKWFGVEGEY 83

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            ..:|::|||||||.||..|.|.||:|:|||||||::.|:||:|...::||||||:|||||:|...
plant    84 SCMVIDLLGPSLEDLFNYCKRIFSLKSVLMLADQLICRVEYMHSRGFLHRDIKPDNFLMGLGRRA 148

  Fly   149 HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLL 213
            :::::||:||:|:|.|::..:|:|.|......|||||||||......|||||||||:||||:|.|
plant   149 NQVYIIDYGLAKKYKDLQTQKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLMYFL 213

  Fly   214 RGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCT 278
            |||||||||...:|.||.:.|.|.|:.|...:||..||:||.:|..|.|.|.||::|||..:|..
plant   214 RGSLPWQGLKAGTKKQKYDKISEKKMLTSVETLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLRRL 278

  Fly   279 FLSLLFNLKFTNDLIYDW 296
            |..|.....:..|.::||
plant   279 FRDLFIREGYQLDYVFDW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 119/239 (50%)
STKc_CK1 17..279 CDD:270918 128/259 (49%)
CKI1NP_193170.1 STKc_CK1_delta_epsilon 14..288 CDD:271027 130/268 (49%)
PHA03307 <305..>436 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.