DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and AT4G08800

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:288 Identity:121/288 - (42%)
Similarity:165/288 - (57%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRI-NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPM 73
            ||| |...:.||:|||:||:||....:.|...||:|.|........|:.||.:|.:|:.|.|||.
plant     3 LRIGNKFRLGRKIGSGAFGEIYLGTDVQSNEDVAIKFESVKTVHPQLAYESRIYRVLQSGNGIPN 67

  Fly    74 TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPE 138
                          |:..|            :||:||||||||||::|||::|...::||||||:
plant    68 --------------MKWYG------------KFSLKTVLMLADQMINRLEFIHSKSFLHRDIKPD 106

  Fly   139 NFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
            |||||      :....||||:::|.|....||:|.|......||..|||:|......||||||:|
plant   107 NFLMG------KAGKSDFGLARKYRDSSSYRHIPYRENKSLTGTPAYASLNTHLGIEQSRRDDVE 165

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:||:|:|.|:|||||:||...:|.||.:.|.|.|:||...:||.|:|.||..||.|.|.|.|::
plant   166 SLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEGHPIEFATYIHYCRSLRFDD 230

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDW 296
            :|||..::..|..|.....|..|.::||
plant   231 KPDYAYLKRLFRDLFIREGFQFDFVFDW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 103/242 (43%)
STKc_CK1 17..279 CDD:270918 111/261 (43%)
AT4G08800NP_192620.1 PKc_like 8..250 CDD:304357 113/273 (41%)
SPS1 8..>205 CDD:223589 96/228 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.