DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and ckl5

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_179537.1 Gene:ckl5 / 816466 AraportID:AT2G19470 Length:433 Species:Arabidopsis thaliana


Alignment Length:300 Identity:139/300 - (46%)
Similarity:197/300 - (65%) Gaps:0/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQF 77
            |...:.||:||||||:||....:.:...||:|:|........||.||.:|.:|:.|.|||....:
plant     7 NKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQGGTGIPNMKWY 71

  Fly    78 FSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLM 142
            .....::||||:|||||||.||:.|.|:||:||||||||||::|||::|...|:||||||:||||
plant    72 GVEGDYNVLVMDLLGPSLEDLFSYCKRQFSLKTVLMLADQMINRLEFIHSKSYLHRDIKPDNFLM 136

  Fly   143 GVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGY 207
            |:|...:::::||:||:|:|.|...:||:|.|......||.||||:|......||||||:||:||
plant   137 GLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIGTPRYASLNTHLGIEQSRRDDIESLGY 201

  Fly   208 VLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDY 272
            :|:|.|:||||||||...:|.||.:.|.|.|:||...:||.|:|.||.:|..|.|.|.|:::|||
plant   202 ILMYFLKGSLPWQGLKAGNKKQKYDKISEKKVSTSIETLCRGHPTEFASYFHYCRSLRFDDKPDY 266

  Fly   273 RMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGSEEDR 312
            ..::..|.:|.....|..|.::||...:....:||:.:.|
plant   267 AYLKRLFRNLFIREGFQFDFVFDWTVYKYQQSQSGNPQPR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 122/242 (50%)
STKc_CK1 17..279 CDD:270918 129/261 (49%)
ckl5NP_179537.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 131/273 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.