DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and VRK2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens


Alignment Length:353 Identity:101/353 - (28%)
Similarity:169/353 - (47%) Gaps:62/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NSIMVIRKLGSGSFGDIY----------EAKH-----------MGSGLHVALKVERKNAGQSHLS 56
            |..::.:|:|||.||.||          :|:|           :.|.|....:|.:|:..:..:.
Human    27 NQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIE 91

  Fly    57 IESTVYNLLRHGMGIPMTY----QFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQ 117
            .:...|      :|||:.|    ..|..|.:..:|||.||..|:.:... |..|...|||.|..:
Human    92 RKQLDY------LGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQ-NGTFKKSTVLQLGIR 149

  Fly   118 MVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHRLHLIDFGLSKRY---WDMKENRHVPQRRGTKW 179
            |:|.|||:|.:.|||.|||..|.|:|. ....:::|.|:|||.||   .:.|:.:..| |:|.. 
Human   150 MLDVLEYIHENEYVHGDIKAANLLLGY-KNPDQVYLADYGLSYRYCPNGNHKQYQENP-RKGHN- 211

  Fly   180 AGTARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPW-QGLLPNSKLQKAEMILEMKLSTLP 243
             ||..:.|::|......|||.|:|.:||.::..|.|.||| |.|.....:|.|:..|   |..||
Human   212 -GTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNL---LDELP 272

  Fly   244 NSLCAGYPN-----EFYNYIIYTRQLGFEEEPDYRMIRCTFLS--------LLFNLKFTNDLIYD 295
            .|:....|:     |...:::....|.::|:|:|:.:: ..|:        |.|:.|..:..::.
Human   273 QSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALK-KILNPHGIPLGPLDFSTKGQSINVHT 336

  Fly   296 WDHAEKNSGKSGSEE-----DRVVVKKV 318
            .:..:.:|.|:.:::     :|::.|||
Human   337 PNSQKVDSQKAATKQVNKAHNRLIEKKV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 86/276 (31%)
STKc_CK1 17..279 CDD:270918 90/295 (31%)
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 91/301 (30%)
SPS1 29..421 CDD:223589 100/351 (28%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3534
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.