DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Csnk1g3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_074046.1 Gene:Csnk1g3 / 64823 RGDID:621408 Length:448 Species:Rattus norvegicus


Alignment Length:315 Identity:122/315 - (38%)
Similarity:185/315 - (58%) Gaps:16/315 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            :|:|.|:||::...|::.:..:||:|:|...:....|.:|...|..|..|.|||..|.|....::
  Rat    47 KKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKY 111

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG--VGL 146
            :.:|:||||||||.||.:|:|.||:|||||:|.|::.|:||:|..:.::||:||||||:|  ...
  Rat   112 NAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNK 176

  Fly   147 TRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211
            .:..:|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::.:|
  Rat   177 AQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMY 241

  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            .||||||||||..::..::.:.|.:.|.:|....||..:|.|...|:.|.|:|.|.|:|||..:|
  Rat   242 FLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLR 306

  Fly   277 CTFLSLLFNLKFTNDLIYDW--------------DHAEKNSGKSGSEEDRVVVKK 317
            ..|..|.....:..|..|||              |.|..::.::....|::...|
  Rat   307 KLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKIQQSK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 103/241 (43%)
STKc_CK1 17..279 CDD:270918 112/261 (43%)
Csnk1g3NP_074046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
STKc_CK1_gamma 42..329 CDD:271028 118/281 (42%)
CK1gamma_C 329..418 CDD:403712 4/33 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..375 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343343
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.