DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Csnk1g1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_017451375.1 Gene:Csnk1g1 / 64086 RGDID:621404 Length:467 Species:Rattus norvegicus


Alignment Length:283 Identity:122/283 - (43%)
Similarity:179/283 - (63%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVE--RKNAGQSHLSIESTVYNLL-RHGMGIPMTYQFFSN 80
            :|:|.|:||::...|::.:..:||:|:|  :..|.|.||  |...|..| ..|.|:|..|.|...
  Rat    48 KKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHL--EYRFYKQLGSAGEGLPQVYYFGPC 110

  Fly    81 RRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG-- 143
            .:::.:|:||||||||.||.:|:|.|::|||||:|.|::.|:||:|..:.::||:||||||:|  
  Rat   111 GKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQ 175

  Fly   144 VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYV 208
            .....|.:|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::
  Rat   176 GNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM 240

  Fly   209 LIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYR 273
            .:|.||||||||||..::..::.:.|.:.|.||...:||..:|.|...|:.|.|:|.|.|:|||.
  Rat   241 FMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLRYVRRLDFFEKPDYE 305

  Fly   274 MIRCTFLSLLFNLKFTNDLIYDW 296
            .:|..|..|.....:|.|..|||
  Rat   306 YLRNLFTDLFERKGYTFDYAYDW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 106/244 (43%)
STKc_CK1 17..279 CDD:270918 115/264 (44%)
Csnk1g1XP_017451375.1 STKc_CK1_gamma 43..331 CDD:271028 122/283 (43%)
CK1gamma_C 331..429 CDD:403712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343344
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.