DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1g2b

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001039315.1 Gene:csnk1g2b / 561724 ZFINID:ZDB-GENE-060825-285 Length:444 Species:Danio rerio


Alignment Length:282 Identity:122/282 - (43%)
Similarity:177/282 - (62%) Gaps:6/282 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVE--RKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNR 81
            :|:|.|:||::...|::.:..:||:|:|  :..|.|.||  |...|..|.:..|:|..:.|....
Zfish    47 KKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHL--EYRFYKQLGNSEGVPQVFYFGPCG 109

  Fly    82 RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG-VG 145
            :::.:|:||||||||.||.:|:|.||:|||||:|.|::.|:|::|....::||:|||||||| .|
Zfish   110 KYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPG 174

  Fly   146 LTR-HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVL 209
            ..| |.:|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::.
Zfish   175 SKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF 239

  Fly   210 IYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRM 274
            :|.||||||||||..::..::.:.|.:.|.:|....||..:|.|...|:.|.|:|.|.|.|||..
Zfish   240 MYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERPDYEY 304

  Fly   275 IRCTFLSLLFNLKFTNDLIYDW 296
            :|..|..|.....|..|..|||
Zfish   305 LRKLFTDLFDRNGFVFDFEYDW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 106/243 (44%)
STKc_CK1 17..279 CDD:270918 115/263 (44%)
csnk1g2bNP_001039315.1 SPS1 42..411 CDD:223589 122/282 (43%)
STKc_CK1_gamma 42..329 CDD:271028 122/282 (43%)
CK1gamma_C 329..403 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.