DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and vrk3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:288 Identity:81/288 - (28%)
Similarity:127/288 - (44%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNA----GQSH----LSIESTV 61
            |.:.|||:.:     |.|           |:.:..:..|:..:.:|    |:.|    |.|.|.|
Zfish   193 ECKYMLRLGA-----KEG-----------HLFNEQNFHLRAAKPDAVEKWGKLHKLDFLGIPSCV 241

  Fly    62 YNLLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLH 126
                  |.|:..||:|        ||...:|..|:|.........|.|.||.||.:::|.||::|
Zfish   242 ------GFGLHETYRF--------LVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIH 292

  Fly   127 LHHYVHRDIKPENFLMGVGLTRH-RLHLIDFGLSKRYWDMKENRHVPQRRGTKWA--GTARYASV 188
            ...|.|.||...|..  :..:.| .:.|..||.:.|:  ....:||..|:|::.|  |...:.|:
Zfish   293 EKEYAHADIHAGNIY--IKSSSHTEVFLSGFGHAFRF--CPGGKHVEYRQGSRTAHQGNISFISL 353

  Fly   189 NALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNE 253
            ::......|||.||:|:||.::..:.|||||..|..||....||.  |..:|.:|..|...|..:
Zfish   354 DSHKGAGPSRRSDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEK--ERYMSDVPGLLTYCYKQK 416

  Fly   254 -----FYNYIIYTRQLGFEEEPDYRMIR 276
                 ...|:.....|.:.|:|||.:::
Zfish   417 KASSALQEYLCNVMALQYTEKPDYTLLK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 72/258 (28%)
STKc_CK1 17..279 CDD:270918 77/276 (28%)
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 81/288 (28%)
SPS1 236..>384 CDD:223589 51/165 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.