DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CSNK1G1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001316534.1 Gene:CSNK1G1 / 53944 HGNCID:2454 Length:475 Species:Homo sapiens


Alignment Length:283 Identity:121/283 - (42%)
Similarity:179/283 - (63%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVE--RKNAGQSHLSIESTVYNLL-RHGMGIPMTYQFFSN 80
            :|:|.|:||::...|::.:..:||:|:|  :..|.|.||  |...|..| ..|.|:|..|.|...
Human    48 KKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHL--EYRFYKQLGSAGEGLPQVYYFGPC 110

  Fly    81 RRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG-- 143
            .:::.:|:||||||||.||.:|:|.|::|||||:|.|::.|:||:|..:.::||:||||||:|  
Human   111 GKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQ 175

  Fly   144 VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYV 208
            .....|.:|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::
Human   176 GNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM 240

  Fly   209 LIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYR 273
            .:|.||||||||||..::..::.:.|.:.|.:|...:||..:|.|...|:.|.|:|.|.|:|||.
Human   241 FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYE 305

  Fly   274 MIRCTFLSLLFNLKFTNDLIYDW 296
            .:|..|..|.....:|.|..|||
Human   306 YLRTLFTDLFEKKGYTFDYAYDW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 105/244 (43%)
STKc_CK1 17..279 CDD:270918 114/264 (43%)
CSNK1G1NP_001316534.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.