DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1g1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_009301749.1 Gene:csnk1g1 / 494092 ZFINID:ZDB-GENE-041212-63 Length:466 Species:Danio rerio


Alignment Length:280 Identity:116/280 - (41%)
Similarity:174/280 - (62%) Gaps:2/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            :|:|.|:||::...|::.:..:||:|:|...:....|.:|...|..|....|:|..:.|....::
Zfish    48 KKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGSADGLPQVFYFGPCGKY 112

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG--VGL 146
            :.:|:||||||||.||.:|:|.||:|||||:|.|::.|:||:|..:.::||:||||||:|  ...
Zfish   113 NAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNK 177

  Fly   147 TRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211
            ..|.:|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::.:|
Zfish   178 KEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMY 242

  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            .||||||||||..::..::.:.|.:.|.:|....||..:|.|...|:.|.|:|.|.|:|||..:|
Zfish   243 FLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLR 307

  Fly   277 CTFLSLLFNLKFTNDLIYDW 296
            ..|..|.....:..|..|||
Zfish   308 NLFTELFDRKGYAFDYSYDW 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 101/241 (42%)
STKc_CK1 17..279 CDD:270918 110/261 (42%)
csnk1g1XP_009301749.1 STKc_CK1_gamma 43..330 CDD:271028 116/280 (41%)
SPS1 43..>265 CDD:223589 93/216 (43%)
CK1gamma_C 330..417 CDD:289378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.