DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1db

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_998415.1 Gene:csnk1db / 406533 ZFINID:ZDB-GENE-040426-2385 Length:409 Species:Danio rerio


Alignment Length:304 Identity:143/304 - (47%)
Similarity:202/304 - (66%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRI-NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPM 73
            ||: |...:.||:|||||||||....:..|..||:|:|........|.|||.:|.:::.|:|||.
Zfish     3 LRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPT 67

  Fly    74 TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPE 138
            .....:...::|:||||||||||.||..|:|:||:||||:|||||:.|:||:|..:::|||:||:
Zfish    68 IKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPD 132

  Fly   139 NFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
            |||||:|...:.:::|||||:|:|.|.:.::|:|.|......|||||||:|......||||||||
Zfish   133 NFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:||||:|...||||||||...:|.||.|.|.|.|:||....||.|||:||..|:.:.|.|.|::
Zfish   198 SLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDD 262

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGSEEDR 312
            :|||..:|..|.:|.....|:.|.::||:..:..:.::..|.||
Zfish   263 KPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGANRTAEEADR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 124/242 (51%)
STKc_CK1 17..279 CDD:270918 131/261 (50%)
csnk1dbNP_998415.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 133/273 (49%)
TyrKc 10..273 CDD:197581 131/262 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..409 3/7 (43%)
Autoinhibitory. /evidence=ECO:0000250 317..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.