DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CG12147

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster


Alignment Length:316 Identity:133/316 - (42%)
Similarity:200/316 - (63%) Gaps:21/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNR 81
            :::::|:||||::::|:.:.....||:|:|........|..|:.:|.:|:.|:|||....:.:..
  Fly    70 LLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHVKHYATEG 134

  Fly    82 RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGL 146
            .::|:||:||||:||.|..:|:|.|||||.||||||::.|:|.||...::||||||:|||||:..
  Fly   135 AYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNFLMGLNR 199

  Fly   147 TRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211
            .:.::::|||||:|:::.::..:|:.........||||||||.|...: ||||||||||||:|:|
  Fly   200 HQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYAE-QSRRDDLESVGYLLLY 263

  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            ..||.|||||:...|:.||.|.|.|.|.:.....||:|.|.||:.|:.|.|:|.|.|:|||    
  Fly   264 FQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKPDY---- 324

  Fly   277 CTFLSLLFNLKFTN-----DLIYDW-----DHAEKNSGKSGSEEDR-----VVVKK 317
             .:|..||.:.|.|     |.::||     :..|:.|.:.|.|.||     |||:|
  Fly   325 -VYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQQKGRERDRGGKRNVVVQK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 107/241 (44%)
STKc_CK1 17..279 CDD:270918 115/261 (44%)
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 116/266 (44%)
SPS1 67..>306 CDD:223589 104/236 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452712
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.