DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and vrk2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_957464.2 Gene:vrk2 / 394145 ZFINID:ZDB-GENE-040426-1046 Length:574 Species:Danio rerio


Alignment Length:289 Identity:86/289 - (29%)
Similarity:136/289 - (47%) Gaps:40/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAK-------------------HMGSGLHVALKVERKNAGQSHLS--IESTVY 62
            :.:|.|.||.||.|.                   |....|...||..::.|....:|  ::|...
Zfish    30 KMIGKGGFGLIYLASQDVNVPVRDDADFVIKVEYHENGPLFSELKFYQRAAKPETMSKWMKSKQL 94

  Fly    63 NLLRHGMGIPMTY-----QFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRL 122
            ..|    ||| ||     ...:..|:..:||:.||..|:.:......:....:||.|...|:|.|
Zfish    95 GFL----GIP-TYWGSGLTESNGTRYRFMVMDRLGTDLQKVLIDNGGQLRKTSVLQLGVLMLDVL 154

  Fly   123 EYLHLHHYVHRDIKPENFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYAS 187
            ||:|.:.|||.|||..|.|:|. ...::::|.|:|||.||....|::...:.......||..|.|
Zfish   155 EYIHDNEYVHADIKAANLLLGY-RDPNKVYLADYGLSYRYCPNGEHKEYKENPKKGHNGTIEYTS 218

  Fly   188 VNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPN-SKLQKAEMILEMKLSTLPNSL----C 247
            ::|......|||.||:.:||.|::...|:|||...|.| :::|:|:..|   :|.||:|:    .
Zfish   219 IDAHKGVAASRRGDLKVLGYCLLHWQCGTLPWLPSLKNPAEVQEAKAKL---MSNLPDSVLKMST 280

  Fly   248 AGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            :....|...::...:.||:.|:|||:.:|
Zfish   281 SSSSMEIAQFLSRVKDLGYNEKPDYQALR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 79/270 (29%)
STKc_CK1 17..279 CDD:270918 86/289 (30%)
vrk2NP_957464.2 STKc_VRK2 13..313 CDD:271025 86/289 (30%)
SPS1 25..406 CDD:223589 86/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.