DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and bsd

DIOPT Version :10

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster


Alignment Length:154 Identity:45/154 - (29%)
Similarity:71/154 - (46%) Gaps:10/154 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 HRDIKPENFLMGVGLTRHRLHLIDFGLSKRYWDMKENRH--VPQRRGTKWAGTARYASVNALCCK 194
            |.|..|..:.. :......:.||||||:.::.|...:|.  :.|||...  ||..:.|.:| ...
  Fly   503 HLDNNPTEYKF-LPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHD--GTLEFTSRDA-HLG 563

  Fly   195 VQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGY----PNEFY 255
            ..|||.|||.:||.|:|...|.|||:.:....:.:|.....|:.::.:|..|...|    |....
  Fly   564 AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLG 628

  Fly   256 NYIIYTRQLGFEEEPDYRMIRCTF 279
            .:::...||.::|.|:|...|..|
  Fly   629 EFLLQIGQLAYQERPNYERYRKIF 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 STKc_CK1 17..279 CDD:270918 44/152 (29%)
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 41/137 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.