DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Vrk1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001012194.1 Gene:Vrk1 / 362779 RGDID:1306069 Length:414 Species:Rattus norvegicus


Alignment Length:333 Identity:94/333 - (28%)
Similarity:151/333 - (45%) Gaps:52/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSGSFGDIY-----EAKHMGSGLHVALKVERKNAGQSHL------------SIESTVYNLLRHG 68
            :|.|.||.||     .:|.:||.....:|||..:.|....            .|:..::......
  Rat    43 IGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIHTHKLKY 107

  Fly    69 MGIPMTYQFFSNRRHD-------VLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLH 126
            :|:|   :::.:..||       .::|:..|..|:.::....:|||.||||.|:.:::|.|||:|
  Rat   108 LGVP---KYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIH 169

  Fly   127 LHHYVHRDIKPENFLMGVGLTRHRLHLIDFGLSKRYWD---MKENRHVPQRRGTKWAGTARYASV 188
            .|.|||.|||..|.|:.. ....:::|:|:||:.||..   .||.:..|:|...   ||..:.|:
  Rat   170 EHEYVHGDIKASNLLLSY-KNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHD---GTLEFTSI 230

  Fly   189 NALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLL--PN----SKLQKAEMILEMKLSTLPNSLC 247
            :|......|||.|||.:||.:|..|.|.|||:..|  ||    ||::..:.:..:.....|.   
  Rat   231 DAHNGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRQSKIRYRDNVAALMEKCFPE--- 292

  Fly   248 AGYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNS--------- 303
            ...|.|...|:...:.|.:.|:|.|:.:|...|..|..:...:|...|:...|..|         
  Rat   293 RNKPGEIAKYMETVKLLDYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVNTKPASKK 357

  Fly   304 GKSGSEED 311
            .|.|:.|:
  Rat   358 RKKGAVEE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 80/270 (30%)
STKc_CK1 17..279 CDD:270918 85/290 (29%)
Vrk1NP_001012194.1 STKc_VRK1 26..326 CDD:271024 85/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.