DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Vrk2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:289 Identity:90/289 - (31%)
Similarity:137/289 - (47%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIY----------EAKHMGSGLHVALKVERKNAGQ--SHLS----------IESTV 61
            :.:|||.||.||          :|:|:       :|||.:..|.  |.|.          |:..|
  Rat    33 KMIGSGGFGLIYLAFPTNKPEKDARHV-------IKVEYQENGPLFSELKFYQRAAKRECIQKWV 90

  Fly    62 YNLLRHGMGIPMTYQF----FSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRL 122
            .......:|:|:.|.|    |..|.:..:|||.||..|:.|... |..|...|||.|..:|:|.|
  Rat    91 KQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLNQ-NGAFKKLTVLQLGIRMLDVL 154

  Fly   123 EYLHLHHYVHRDIKPENFLMGVGLTRHRLHLIDFGLSKRYWDMKENR--HVPQRRGTKWAGTARY 185
            ||:|.:.|||.|||..|.|:|.. ...|::|.|:|||.||.....::  |...|:|..  ||..:
  Rat   155 EYIHENEYVHGDIKAANLLLGYA-NPDRVYLADYGLSYRYCPNGNHKQYHEDPRKGHN--GTLEF 216

  Fly   186 ASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNS---KLQKAEMILEMKLSTLPNSLC 247
            .|::|......|||.|:|.:||.::..|.|.|||:..|.|.   :..|.:::.|:..|.|..:..
  Rat   217 TSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPWETNLENPVAVQTAKTKLLDELPESVLKWTTS 281

  Fly   248 AGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            .....|...:.:|...|.::.:|||:.::
  Rat   282 GSSCRELAEFFMYVHNLAYDAKPDYQKLK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 85/270 (31%)
STKc_CK1 17..279 CDD:270918 90/289 (31%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 90/289 (31%)
Pkinase 29..290 CDD:278497 85/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.