DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1da

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_955877.1 Gene:csnk1da / 322106 ZFINID:ZDB-GENE-030131-825 Length:403 Species:Danio rerio


Alignment Length:304 Identity:143/304 - (47%)
Similarity:201/304 - (66%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRI-NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPM 73
            ||: |...:.||:|||||||||....:.:|..||:|:|........|.|||.:|.:::.|:|||.
Zfish     3 LRVGNRYRLGRKIGSGSFGDIYLGTDITTGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPT 67

  Fly    74 TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPE 138
            .....:...::|:||||||||||.||..|:|:||:||||:|||||:.|:||:|..:::|||:||:
Zfish    68 IKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPD 132

  Fly   139 NFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
            |||||:|...:.:::|||||:|:|.|.:.::|:|.|......|||||||:|......||||||||
Zfish   133 NFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:||||:|...||||||||...:|.||.|.|.|.|:||....||.|||:||..|:.:.|.|.|::
Zfish   198 SLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDD 262

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGSEEDR 312
            :|||..:|..|.:|.....|:.|.::||:..:....:...|.||
Zfish   263 KPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGGAREDPERDR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 124/242 (51%)
STKc_CK1 17..279 CDD:270918 131/261 (50%)
csnk1daNP_955877.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 133/273 (49%)
SPS1 9..380 CDD:223589 140/298 (47%)
Autoinhibitory. /evidence=ECO:0000250 315..340
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.