DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Ttbk2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006234899.2 Gene:Ttbk2 / 311349 RGDID:1311661 Length:1311 Species:Rattus norvegicus


Alignment Length:301 Identity:93/301 - (30%)
Similarity:151/301 - (50%) Gaps:27/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFS-- 79
            |:||:|.|.||:||:|..|.:..:||||||.....:..|.:|..|...|:   |.....:|..  
  Rat    92 VLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQ---GKDHVCRFIGCG 153

  Fly    80 -NRRHDVLVMELLGPSLETLFTMCNR-RFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLM 142
             |.|.:.:||:|.|.:|..|....:| .|::.|.|.|..|:::.:|.:|...::||||||.||.|
  Rat   154 RNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAM 218

  Fly   143 G-VGLTRHRLHLIDFGLSKRY----WDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDL 202
            | ...|..:..::||||::::    .|::     |.|....:.||.||||:||...:...|.|||
  Rat   219 GRFPSTCRKCFMLDFGLARQFTNSCGDVR-----PPRAVAGFRGTVRYASINAHRNREMGRHDDL 278

  Fly   203 ESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFE 267
            .|:.|:|:..:.|.|||:      |::..|.:..:|.......:....|.||..::.:...|.:.
  Rat   279 WSLFYMLVEFVVGQLPWR------KIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYF 337

  Fly   268 EEPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGS 308
            .:|||:::...|.:.:..........:||:    .||..||
  Rat   338 TKPDYQLLTSVFDNSIKTFGVIESDPFDWE----KSGTDGS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 82/250 (33%)
STKc_CK1 17..279 CDD:270918 86/270 (32%)
Ttbk2XP_006234899.2 STKc_TTBK2 89..350 CDD:271031 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.