DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Vrk1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001351296.1 Gene:Vrk1 / 22367 MGIID:1261847 Length:440 Species:Mus musculus


Alignment Length:337 Identity:99/337 - (29%)
Similarity:156/337 - (46%) Gaps:62/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSGSFGDIY-----EAKHMGSGLHVALKVERKNAGQSHLSIESTVY---------------NLL 65
            :|.|.||.||     .:|.:||.....:|||..:.|.  |..|...|               :.|
Mouse    43 IGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGP--LFTELKFYQRAAKPEQIQKWIRTHKL 105

  Fly    66 RHGMGIPMTYQFFSNRRHD-------VLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLE 123
            :: :|:|   :::.:..||       .::|:..|..|:.::....:|||.||||.|:.:::|.||
Mouse   106 KY-LGVP---KYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILE 166

  Fly   124 YLHLHHYVHRDIKPENFLMGVGLTRHR----LHLIDFGLSKRYWD---MKENRHVPQRRGTKWAG 181
            |:|.|.|||.|||..|.|:.     |:    ::|:|:||:.||..   .||.:..|:|...   |
Mouse   167 YIHEHEYVHGDIKASNLLLS-----HKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHD---G 223

  Fly   182 TARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLL--PN----SKLQKAEMILEMKLS 240
            |..:.|::|......|||.|||.:||.:|..|.|.|||:..|  ||    ||::..:.:..:...
Mouse   224 TLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEK 288

  Fly   241 TLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGK 305
            ..|..   ..|.|...|:...:.|.:.|:|.|:.:|...|..|..:...:|...|:...|     
Mouse   289 CFPEK---NKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVE----- 345

  Fly   306 SGSEEDRVVVKK 317
            :||.:.|...||
Mouse   346 NGSVKTRPASKK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 84/277 (30%)
STKc_CK1 17..279 CDD:270918 89/297 (30%)
Vrk1NP_001351296.1 STKc_VRK1 26..326 CDD:271024 89/299 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.