DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1a1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_009289361.1 Gene:csnk1a1 / 192307 ZFINID:ZDB-GENE-020419-19 Length:365 Species:Danio rerio


Alignment Length:327 Identity:151/327 - (46%)
Similarity:198/327 - (60%) Gaps:36/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNR 81
            ::||:|||||||||.|.::.:|..||:|:|.:.|....|..||.:|.:|:.|:|||....:...:
Zfish    19 LVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEK 83

  Fly    82 RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGL 146
            .::||||:|||||||.||..|:|||:|||||||||||:.|:||:|..:::||||||:|||||:| 
Zfish    84 DYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIG- 147

  Fly   147 TRH------------------------------RLHLIDFGLSKRYWDMKENRHVPQRRGTKWAG 181
             ||                              :|.||||||:|:|.|.:..:|:|.|......|
Zfish   148 -RHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTG 211

  Fly   182 TARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSL 246
            ||||||:||.....||||||:||:||||:|..|.|||||||...:|.||.|.|.|.|:||....|
Zfish   212 TARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVL 276

  Fly   247 CAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW----DHAEKNSGKSG 307
            |.|:|.||..|:.|.|.|.|||.|||..:|..|..|...|....|..:||    ..|.:.:..||
Zfish   277 CKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSG 341

  Fly   308 SE 309
            .:
Zfish   342 GQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 132/271 (49%)
STKc_CK1 17..279 CDD:270918 142/291 (49%)
csnk1a1XP_009289361.1 STKc_CK1_alpha 16..309 CDD:271030 142/291 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.