DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and ZK507.1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_499015.2 Gene:ZK507.1 / 191336 WormBaseID:WBGene00013978 Length:331 Species:Caenorhabditis elegans


Alignment Length:282 Identity:72/282 - (25%)
Similarity:117/282 - (41%) Gaps:83/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ALKVERKNAGQ--SHLSIESTVY---------------NLLRHGMGIPMTYQFFSNRRHDVLVME 89
            |:|.|.|.|.:  |.|.||..|.               .|:..|......:          :||.
 Worm    16 AMKTELKFASKHSSRLKIERNVMESYSKCDAQCKEHFSELIDFGQSPVWKW----------IVMT 70

  Fly    90 LLGPSLETLFTMCNRRFSMK---------TVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVG 145
            ::|||||.|        .||         |:|....|.:..:...|...::||||||.|:.:|.|
 Worm    71 IVGPSLEEL--------KMKYKPSDIPPSTILQCGLQTMKAIHDFHQIGFLHRDIKPANYCIGYG 127

  Fly   146 LTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLI 210
            .....::::||||:::| .:...:..|.|..||..||.||.|..:..|:...||||.||..::.|
 Worm   128 SKSETIYVLDFGLARKY-RLPNGQVRPPRPKTKMIGTPRYCSRASHRCEELGRRDDYESWFFMFI 191

  Fly   211 YLLRGSL-PWQGLL-PNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYR 273
            .|:..:| .|:||. |::..:|.|:..::|.                          :|:.|.::
 Worm   192 DLVDTTLIDWKGLTRPDAYAKKQELFTKLKT--------------------------YEKHPMFK 230

  Fly   274 MIRCTFLSLLFNLKFTNDLIYD 295
            :|..          :.::|:||
 Worm   231 VISI----------YLDNLVYD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 66/244 (27%)
STKc_CK1 17..279 CDD:270918 69/264 (26%)
ZK507.1NP_499015.2 SPS1 9..>168 CDD:223589 48/170 (28%)
PKc_like 10..252 CDD:304357 72/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.