DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and ZK354.6

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_500772.1 Gene:ZK354.6 / 191293 WormBaseID:WBGene00022707 Length:368 Species:Caenorhabditis elegans


Alignment Length:312 Identity:87/312 - (27%)
Similarity:147/312 - (47%) Gaps:31/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPM-----TYQFFSN 80
            :|.|.|..||:|.........|:|||.::.....:.:|.||...||..||||.     .:|...|
 Worm    75 IGGGGFAQIYKAWDKVRKEDCAIKVEHESQDIRRMKLEITVLLALRGSMGIPEILAQGKWQHEDN 139

  Fly    81 RRHDVLVMELLGPSL-ETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGV 144
            :.| .:||:|:|.:| :....:.::|.:.:|:.....|::..|..:|...::|||:||.|..:| 
 Worm   140 KSH-YIVMQLVGRNLSDVRRALPHKRITERTLYRAMIQVLKALSLVHGAGFLHRDLKPSNCCIG- 202

  Fly   145 GLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVL 209
            .:...|::|||:||:::|.|.......| |.|....||.||.|::|...:....::||.:..|..
 Worm   203 AIDCTRIYLIDYGLTRQYLDKGGIVRKP-RAGVGLRGTVRYMSLDAHARQDLGPKNDLVAFLYTT 266

  Fly   210 IYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYP--NEFYNYIIYTRQLGFEEEPDY 272
            |....|.|||      |..:..|.|:::|.:.:.:.||...|  .:...||   ..|.:...|||
 Worm   267 IECGDGYLPW------SHEKTHENIIKLKQAHIGDKLCTKQPVMTKAAEYI---ESLNYHSIPDY 322

  Fly   273 RMIRCTFLSLLF-----NLKFTNDLIYDWDHAEKNSGKSGSEEDRVVVKKVV 319
            ..:    |:|:.     :||.:..  |||.:....:|..|..::.|..:..:
 Worm   323 EKL----LALMEECNPPDLKESEP--YDWQYRHLPNGTPGGTKENVTERMAI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 72/245 (29%)
STKc_CK1 17..279 CDD:270918 77/265 (29%)
ZK354.6NP_500772.1 PKc_like 68..330 CDD:389743 79/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.