DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and ZC581.2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_491912.3 Gene:ZC581.2 / 191200 WormBaseID:WBGene00022632 Length:342 Species:Caenorhabditis elegans


Alignment Length:316 Identity:94/316 - (29%)
Similarity:144/316 - (45%) Gaps:29/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVE---RKNAGQSHLSIESTVYNLLRHG 68
            :.|.| ...||...:|.|.||.||..........|.:|:|   .|...:..:.:|..|...|:..
 Worm    41 DQMFR-GKFMVKGLIGRGGFGQIYYGSDATFPEDVVIKIEPVVLKGRPRRRMILEQKVLYRLQGR 104

  Fly    69 MGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCN-RRFSMKTVLMLADQMVDRLEYLHLHHYVH 132
            ..:|:........:.:.:||:||||::..|..... :|.|..||..:..|.:..|..:|...|:|
 Worm   105 PHVPIMCASGHTEQLNFIVMQLLGPNIGDLKKRSPVKRLSQTTVARIMIQGIAALRDVHSLGYIH 169

  Fly   133 RDIKPENFLMGV-GLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQ 196
            ||:||.|...|| ..|||.|.|:|:|:.:|:.::...|. .||....:.||.||:||.....|.|
 Worm   170 RDVKPANMCFGVTQSTRHVLKLVDYGMVRRFKNVDGTRR-KQRYKPGFRGTLRYSSVRVHDGKEQ 233

  Fly   197 SRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLS-TLPNS----LCAGYPNEFYN 256
            :..||..|:.|....||..:|||       ||...:.|.:.|:. ..|||    |...|.:.|..
 Worm   234 TPVDDFVSMAYSGAELLLVNLPW-------KLVSTDDIRQTKVDFNTPNSPYLLLTGPYFSVFCG 291

  Fly   257 YIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDL--IYDWDHAEKNS-GKSGSE 309
            .|...|.   |:|||:..::    :||.::.....|  .||||...::: |.|.::
 Worm   292 AIFNLRS---EDEPDHSSLQ----NLLCDMTRGKSLREAYDWDENYRDALGSSNTD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 77/252 (31%)
STKc_CK1 17..279 CDD:270918 82/271 (30%)
ZC581.2NP_491912.3 PKc_like 47..311 CDD:389743 83/278 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.