DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and W06F12.3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_499835.1 Gene:W06F12.3 / 189253 WormBaseID:WBGene00012307 Length:318 Species:Caenorhabditis elegans


Alignment Length:314 Identity:81/314 - (25%)
Similarity:140/314 - (44%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELETMLRINSIMVIRKL-GSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHG 68
            |..|::.:.....:.|: |.|.||.|:.|..|.:.|.||:|||.|:.....:.:|..:...|.|.
 Worm    27 ETGTIIGLKRPFQVEKMVGGGGFGQIFRAVDMETKLVVAVKVEPKSVESGRIVLELHILVELAHS 91

  Fly    69 MGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRR-FSMKTVLMLADQMVDRLEYLHLHHYVH 132
            ..||..:.......::.:||:|||.::..|......| ||.:|...:..|.::.|:.:|...|:|
 Worm    92 PHIPKVHYSGEIGGYNFIVMQLLGSNITDLRKFQKGRCFSAETTARVGIQCLEGLKQIHELGYIH 156

  Fly   133 RDIKPENFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQS 197
            |||||.|..:|:|..:..|:::|||::::. ........|:|....:.||.||.|:.|...|.|.
 Worm   157 RDIKPSNICVGIGEHKRVLYIVDFGMARQI-RFPSGAFRPERPYASFRGTTRYVSLAAHERKEQG 220

  Fly   198 RRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMIL---------EMKLSTLPNSLCAGYPNE 253
            ..||:..:.:.|:.|..| |||:.::...::..|:.:|         .....|.|.:|       
 Worm   221 FADDIWCLFFSLLELAEG-LPWKNVVDQDQVYHAKQLLLRNFQSRKMGQNFGTFPRAL------- 277

  Fly   254 FYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW------DHAEK 301
                    ..:...|.|:|.       :.:..||..:..:.:|      ||.|:
 Worm   278 --------ELIKRTETPNYE-------NFIVILKSCSSRVNEWEEFEWDDHDEQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 70/253 (28%)
STKc_CK1 17..279 CDD:270918 73/272 (27%)
W06F12.3NP_499835.1 PKc_like 38..289 CDD:389743 72/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.