DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and R10D12.10

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_506465.2 Gene:R10D12.10 / 187766 WormBaseID:WBGene00011191 Length:497 Species:Caenorhabditis elegans


Alignment Length:325 Identity:79/325 - (24%)
Similarity:136/325 - (41%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLR---HGMGIP 72
            ::.|...|.::..|....:.........:..|:|||:.:......|||..|...||   |...|.
 Worm    23 KLGSWFSIGEIAKGDLSTVSRVIDSEGKIEAAMKVEKLSKDSKKRSIEKDVLEALRDSPHSAHII 87

  Fly    73 M-----TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVH 132
            .     .|:|        .||.|.||:|..:..:.:.:||..|:|.|:.:.:..::.||.|.::|
 Worm    88 EQLLIGDYRF--------TVMTLSGPTLGIIKHIMDNKFSDSTILRLSMRTLMAIKDLHEHGFIH 144

  Fly   133 RDIKPENFLMGVGLTRHRLHLIDFGLSKRY-------WDMKENRHVPQRRGTKWAGTARYASVNA 190
            ||::|.|..:....:...:.|:|||.::::       |.:::.|.....||:.     :|.|...
 Worm   145 RDLEPFNIALSPYKSSRNILLLDFGEARQFARNDNGKWMLRKPRDKAPFRGSD-----QYCSPRM 204

  Fly   191 LCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKL--QKAEMILEMKLSTLPNSLCAGYP-- 251
            ...:.|.|.|||.|..||.:. ||..|||.......|.  .|.|::         :.|.|..|  
 Worm   205 HNHEEQGRVDDLWSWLYVFVE-LRAFLPWTDSTSRFKYGPLKRELL---------DDLLASDPFI 259

  Fly   252 NEFYNYIIYTRQLGFEEEPD----YRMIRCTFLSLLFNLKFTNDLIYDWDHAEKN-SGKSGSEED 311
            ..|...:...|:..:.:.||    |.::.....|:  .:|:|:.:.:|....:.| ..||.|.|:
 Worm   260 TTFCPIVTLLREGKYADRPDYGKIYEILAAKMTSM--GVKWTDPMDFDLQADKPNYFSKSPSNEE 322

  Fly   312  311
             Worm   323  322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 65/261 (25%)
STKc_CK1 17..279 CDD:270918 69/284 (24%)
R10D12.10NP_506465.2 PKc_like 27..287 CDD:389743 69/282 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.