DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and K06H7.8

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_498768.1 Gene:K06H7.8 / 187079 WormBaseID:WBGene00019459 Length:346 Species:Caenorhabditis elegans


Alignment Length:352 Identity:97/352 - (27%)
Similarity:155/352 - (44%) Gaps:82/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETMLRINSIM-----VIRKLGSGSFGDIYEAKHMG-SGLHVALKVERK--NAGQSHLSIESTVYN 63
            |..|.|.:::     |::|||.|..|.:::.:... .|.|.|||||.|  :||           |
 Worm     7 EETLEIGAVVGKRYKVVQKLGEGGCGSVFKVEDTSEKGQHYALKVEFKSQDAG-----------N 60

  Fly    64 LLRHGMGIPMTYQFFSNR------------RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLAD 116
            :|:  |.:.:..|..|.:            |:..:||.|||.||::|........::.|.:.:..
 Worm    61 ILK--MEVQILSQLISKKHVAKCVASGKKERYSYMVMTLLGESLDSLLKKHGPFLNVSTQVRIGI 123

  Fly   117 QMVDRLEYLHLHHYVHRDIKPENFLMGV-GLTRHRLHLI-DFGLSKRYW-----DMKENRHVPQR 174
            .::..::.:|...|:|||:||.|..||. |....|..|: ||||:::|.     .:|..|   .|
 Worm   124 CILFGIKQVHDIGYLHRDLKPANVAMGCKGSADERYFLVLDFGLARQYIADEDDGLKMRR---PR 185

  Fly   175 RGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLL---RGSLPWQGLLPNSKLQKAEMILE 236
            ..|.:.|||||.||.......|.|.|||    :.|:|:|   |..|.|..:  :.|::    |.|
 Worm   186 EKTYFRGTARYCSVAMHDRYEQGRVDDL----WALVYILAEMRCRLAWHDV--DDKVE----IGE 240

  Fly   237 MKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYR--------MIRCTFLSLLFNLKFTNDLI 293
            ||.......|.|..|.:..:::...|...|...|||.        :::|.      |.|:::.  
 Worm   241 MKRKIHDEVLFAKSPVQMLSFVKTVRSTLFYHRPDYEKLFKLLEDVMKCA------NYKWSDP-- 297

  Fly   294 YDWDHAEKNS----------GKSGSEE 310
            |.|:..:|.:          ||.|::|
 Worm   298 YHWEPEKKKNPASQGNKFGLGKKGTKE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 79/272 (29%)
STKc_CK1 17..279 CDD:270918 85/294 (29%)
K06H7.8NP_498768.1 STKc_TTBK 19..284 CDD:270919 84/290 (29%)
S_TKc 20..263 CDD:214567 79/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.