DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and K04C1.5

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_510376.1 Gene:K04C1.5 / 186980 WormBaseID:WBGene00010555 Length:255 Species:Caenorhabditis elegans


Alignment Length:235 Identity:62/235 - (26%)
Similarity:101/235 - (42%) Gaps:55/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NLLRH--GM-GIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNR----RFSMKTVLMLADQMVD 120
            :.|:|  |: |:|:.::.|...:..||||:   ..||.|.....|    :.|.:.|:.||.::|.
 Worm    18 DFLKHLAGINGVPVVHKHFQYEQKRVLVMD---KYLENLEQFRKRKEDEKLSPRVVIKLAFRLVS 79

  Fly   121 RLEYLHLHHYVHRDIKPENFLMG--VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTA 183
            .||::|....||:|||.:|.:.|  || .:..:.|||:|:: .:...|..|.:..  |.....|.
 Worm    80 ILEHIHRKGVVHQDIKLDNVVFGAKVG-NKLDIVLIDYGIA-AFTKPKPPRDLVD--GALHCTTD 140

  Fly   184 RYASVNALCCKVQSRR----DDLESVGYVLI---------------------YLLRGSLPWQG-- 221
            ..:||.|....||..:    |||:.:.::|:                     ::.:.|:..||  
 Worm   141 FSSSVYASPGLVQGLKGDPVDDLQMLSFMLLWASKYNPFGEDSLESLRKKKEFIAKPSIFTQGDY 205

  Fly   222 --LLPNSKLQKAEMILEMKLSTLP-----NSLCAGYPNEF 254
              |.|     ....|:|.|.|..|     :..||...|.|
 Worm   206 KFLRP-----VISKIMEQKRSKRPDYKAISKKCANKDNYF 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 62/235 (26%)
STKc_CK1 17..279 CDD:270918 62/235 (26%)
K04C1.5NP_510376.1 PKc_like 15..>171 CDD:389743 47/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.