DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and F59E12.3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_495099.2 Gene:F59E12.3 / 186628 WormBaseID:WBGene00019119 Length:141 Species:Caenorhabditis elegans


Alignment Length:121 Identity:31/121 - (25%)
Similarity:55/121 - (45%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIE-STVYNLLRHG 68
            ||.|  .|::..:..|:..||||.|::.....:|..:.||.|...:..:.|.|| .|:..:.|..
 Worm    14 ELTT--SISTYTINEKIAEGSFGAIFKVTEKSTGTRLVLKAELPGSPSNDLRIELVTMLRVFRSY 76

  Fly    69 MGIPMTYQFFSNRRHDVLVMELLGPSLETLF-TMCNRRFSMKTVLMLADQMVDRLE 123
            :........|:..:  .|:|.|.|.|||.:. .:...:.|:.|.:....|.::.:|
 Worm    77 VPEVTDKGVFNGTK--FLIMPLFGKSLEDIIGALPGNKCSLSTAIGSLYQCLEAIE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 27/110 (25%)
STKc_CK1 17..279 CDD:270918 27/109 (25%)
F59E12.3NP_495099.2 PKc_like 21..>130 CDD:304357 26/110 (24%)
SPS1 22..>130 CDD:223589 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.