DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and F33D11.7

DIOPT Version :10

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_491697.1 Gene:F33D11.7 / 185229 WormBaseID:WBGene00018004 Length:347 Species:Caenorhabditis elegans


Alignment Length:243 Identity:51/243 - (20%)
Similarity:73/243 - (30%) Gaps:111/243 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DQKEYLK---RYLSNDKDAKKKKKKK------DKLKAA-----------------------KKAN 41
            |:|::|.   :|:.|. |.||.....      |:|..|                       |.:|
 Worm   634 DEKDHLALIYQYMVNG-DLKKHFSGSSIISWVDRLNIAVDAASGLEYLHIGCKPLIVHRDVKSSN 697

  Fly    42 VVIVDD------DLDLSAL-----QSRIDDNETDLFG-LDEEAPQ----------------VVGI 78
            :::.|.      |..||..     :|.:.......|| ||.|..|                ::.|
 Worm   698 ILLDDQLQAKLADFGLSRSFPIGDESHVSTLVAGTFGYLDHEYYQTNRLSEKSDVYSFGVVLLEI 762

  Fly    79 IDERP-----------------------------PELRAKEDFSSAKWKALNANDGGFDAMLRAN 114
            |..:|                             |:|:...|..|| ||||..      ||...|
 Worm   763 ITNKPVIDHNRDMPHIAEWVKLMLTRGDISNIMDPKLQGVYDSGSA-WKALEL------AMTCVN 820

  Fly   115 ES--KRPDGN------AEARVSFKAQGAKTERRRKYD------SDENP 148
            .|  |||:.:      .|..||...:....:..|..|      :|.||
 Worm   821 PSSLKRPNMSHVVHELKECLVSENNRTRDIDTSRSMDINLSFGTDVNP 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 STKc_CK1 17..279 CDD:270918 48/232 (21%)
F33D11.7NP_491697.1 STKc_TTBK 41..315 CDD:270919
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.