DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and F26A1.4

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_497995.2 Gene:F26A1.4 / 184945 WormBaseID:WBGene00017803 Length:206 Species:Caenorhabditis elegans


Alignment Length:215 Identity:57/215 - (26%)
Similarity:94/215 - (43%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QMVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAG 181
            |::..|..:|...::||||||.|..:| .....|::|||:.|:::|.|.......| |.|....|
 Worm     3 QVLKALALVHRAEFLHRDIKPPNCCIG-ATDCTRIYLIDYVLTRQYLDKCGTVRNP-RPGLGLRG 65

  Fly   182 TARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSL 246
            |.||.|::|...:....::||.|..|..|....|.|||      |..:..|..:::|.:.:...|
 Worm    66 TMRYMSLDAHARQDLGPKNDLVSFLYTTIECGDGCLPW------SYEKSEENCIKLKQAHIGEKL 124

  Fly   247 CAGYP--NEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLL-----FNLKFTNDLIYDWDHAEKN-- 302
            |...|  .:...||   ..|.:...|||..:    |:|:     .:||.:..  |:|.:.:.:  
 Worm   125 CIKKPLMTKAAEYI---ESLNYHSIPDYEKL----LALIEECNPADLKESEP--YEWQYRQPHNP 180

  Fly   303 ---------SGKSGSEEDRV 313
                     :|..|..::.|
 Worm   181 MTPTTGEGLNGTPGGTKENV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 43/143 (30%)
STKc_CK1 17..279 CDD:270918 48/163 (29%)
F26A1.4NP_497995.2 PKc_like <3..157 CDD:389743 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.