DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and F22H10.1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_510698.2 Gene:F22H10.1 / 184871 WormBaseID:WBGene00017725 Length:207 Species:Caenorhabditis elegans


Alignment Length:233 Identity:50/233 - (21%)
Similarity:93/233 - (39%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHRLH 152
            |.:.|.:|..:......|.|...::.:|..:.:.|.|:|...::|||:|.:|.::........|.
 Worm     1 MSMEGCNLRDIGKQTPGRLSFNNLMRVAYTLGNTLCYIHDRGFIHRDLKADNVVVTFSNEVCTLK 65

  Fly   153 LIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSL 217
            |||||.:.|..|...|:....:.|..::..::: |||.:.....::.||..|:.|:|: .:|| .
 Worm    66 LIDFGKAIRIKDQNGNQLPGHQDGIDYSRCSQH-SVNVILGIAPTQNDDWSSLVYLLM-KMRG-F 127

  Fly   218 PWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEP-DYRMIRCTFLS 281
            .|.        ..||.:|::|:.                         ||.:| |.......::.
 Worm   128 SWG--------DTAEEMLDLKVQ-------------------------FENDPKDMIAQDMMWMR 159

  Fly   282 LLFNLKFTNDLIYDWDHAEKNSGKSGSEEDRVVVKKVV 319
            .::......|:              |.|.:|.:|.|:|
 Worm   160 QIYRNAVNEDM--------------GRENNRGIVDKLV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 39/170 (23%)
STKc_CK1 17..279 CDD:270918 43/191 (23%)
F22H10.1NP_510698.2 PKc <3..127 CDD:270622 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.