DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and prde-1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_506866.3 Gene:prde-1 / 184750 WormBaseID:WBGene00008995 Length:526 Species:Caenorhabditis elegans


Alignment Length:199 Identity:51/199 - (25%)
Similarity:76/199 - (38%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GIPMTYQFFSNRRHDVLVMELLGPSLETLF-TMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHR 133
            ||...:.||      ::|....||:|..|. .:.:.:.|:.|...||..|:..:|.|....:|.|
 Worm   101 GIINNHVFF------MVVRIRAGPTLHDLLKCLSSDKMSVTTASFLAVDMISAIEILSASGWVLR 159

  Fly   134 ---------DIKPENFLM--GVGLT-----RHR----LHL-----IDFGLSKRYWDMKENRHVPQ 173
                     |||...|.:  ...:|     |||    :||     ||.     :|...:..:.|:
 Worm   160 NFDSKQWMLDIKTRQFYLADATDITVSSDKRHRAIDEIHLRTAESIDL-----HWKTGDLIYAPR 219

  Fly   174 RRGTKWAGTARYASVNALCCKVQSRR----DDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMI 234
                            :...:.||.|    |.:|.:.|||.....|.|||:    :||  ..|.|
 Worm   220 ----------------SFVDRDQSHRMTELDMMEMMLYVLYDWTHGKLPWK----SSK--SRERI 262

  Fly   235 LEMK 238
            :|||
 Worm   263 MEMK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 51/199 (26%)
STKc_CK1 17..279 CDD:270918 51/199 (26%)
prde-1NP_506866.3 SPS1 86..350 CDD:223589 51/199 (26%)
PKc_like <94..294 CDD:304357 51/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.