Sequence 1: | NP_608697.1 | Gene: | CG9962 / 33448 | FlyBaseID: | FBgn0031441 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506866.3 | Gene: | prde-1 / 184750 | WormBaseID: | WBGene00008995 | Length: | 526 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 76/199 - (38%) | Gaps: | 63/199 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 GIPMTYQFFSNRRHDVLVMELLGPSLETLF-TMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHR 133
Fly 134 ---------DIKPENFLM--GVGLT-----RHR----LHL-----IDFGLSKRYWDMKENRHVPQ 173
Fly 174 RRGTKWAGTARYASVNALCCKVQSRR----DDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMI 234
Fly 235 LEMK 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9962 | NP_608697.1 | SPS1 | 16..>259 | CDD:223589 | 51/199 (26%) |
STKc_CK1 | 17..279 | CDD:270918 | 51/199 (26%) | ||
prde-1 | NP_506866.3 | SPS1 | 86..350 | CDD:223589 | 51/199 (26%) |
PKc_like | <94..294 | CDD:304357 | 51/199 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |