DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and D2045.5

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_499308.1 Gene:D2045.5 / 183952 WormBaseID:WBGene00008423 Length:351 Species:Caenorhabditis elegans


Alignment Length:320 Identity:88/320 - (27%)
Similarity:144/320 - (45%) Gaps:57/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGS-GLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFF-- 78
            ::.|||.|..|.:::.:.:.. ..:.|:|||...:....|.:|:   ::|:....:|...:..  
 Worm    19 IVEKLGEGGMGAVFKVRDLTRFQTYAAMKVEGDVSDGGVLKLEA---HVLKSLAPLPFCARLMDA 80

  Fly    79 -SNRRHDVLVMELLGPSLETLFTMCNR------RFSMKTVLMLADQMVDRLEYLHLHHYVHRDIK 136
             ..:.:..:||.|||..|     |.::      ||..:|.|.||...:..::.:|...:.|||||
 Worm    81 GDRKSYCFMVMTLLGKDL-----MAHKRDANTPRFCEQTTLRLAMATLFAIKQIHEVGFTHRDIK 140

  Fly   137 PENFLMGV-GLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTK----WAGTARYASVNALCCKVQ 196
            |.|.:.|| |.....::|||:|:.:::...:||.....||...    :.||.||.|:|....|.|
 Worm   141 PGNCVTGVHGSDAKNVYLIDYGMVRQFTAKRENGETALRRARSGEQLFRGTPRYCSMNVHNRKEQ 205

  Fly   197 SRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYT 261
            .|.|||.|..|:||.|..| |||:      :|...:.|::.|::....:|..|.|.||.|...|.
 Worm   206 GRVDDLWSWLYMLIELHCG-LPWR------RLTDEKEIMDAKIACSMETLLKGCPKEFANIHKYL 263

  Fly   262 RQLGFEEEPDY-----------RMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGSEE 310
            ..|.::..|||           :.:|.:|...           ::|:     .||.|.||
 Worm   264 ETLEYKSRPDYFGLWSECFAGFKRVRGSFFGR-----------FEWE-----LGKGGGEE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 75/256 (29%)
STKc_CK1 17..279 CDD:270918 81/287 (28%)
D2045.5NP_499308.1 STKc_TTBK 16..277 CDD:270919 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.