DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and C55B7.10

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_491873.4 Gene:C55B7.10 / 183845 WormBaseID:WBGene00016946 Length:369 Species:Caenorhabditis elegans


Alignment Length:296 Identity:88/296 - (29%)
Similarity:138/296 - (46%) Gaps:40/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH-- 83
            ||.|.:|.::.::  ...:.:|:|.|:  ..:|.|.||..|   |:..|.        :|.:|  
 Worm    67 LGDGGYGTVFLSQ--DDDIKIAVKTEK--FSKSQLKIEIVV---LKAAMQ--------ANCKHFC 116

  Fly    84 ------------DVLVMELLGPSLETLFTMC---NRRFSMKTVLMLADQMVDRLEYLHLHHYVHR 133
                        |.:::.|||..|..|  .|   .|:||:.|.|.:..|.:...|.||...:|.|
 Worm   117 ELVDCGTKGKDFDYMMITLLGKDLHKL--RCELPGRKFSINTALRIGIQTLKACEELHRIGFVSR 179

  Fly   134 DIKPENFLMGVGLTR--HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQ 196
            |:||.||..||...|  ..:.:.||||:::|.| |.|:.:|.|:...|.||.||.|:||......
 Worm   180 DVKPGNFAPGVKSNRQSRTIFMYDFGLARKYID-KNNQVIPTRKEVGWRGTTRYGSLNAHKRLDL 243

  Fly   197 SRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYT 261
            .|||||||..|.|:.:.||:|||:.::..|.:|:|:   |...:|.........|:::.......
 Worm   244 GRRDDLESWFYGLVEMTRGTLPWRNVVDRSSVQRAK---EASHNTGRTQFLFETPSQYDKIFTIV 305

  Fly   262 RQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDWD 297
            ....||..|||:.|....:......:..:...:||:
 Worm   306 DSYAFESAPDYKQINKLLVEAREERQLRDREHWDWE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 80/256 (31%)
STKc_CK1 17..279 CDD:270918 86/276 (31%)
C55B7.10NP_491873.4 PKc_like 60..323 CDD:389743 86/276 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.