DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and C25H3.1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001379695.1 Gene:C25H3.1 / 182922 WormBaseID:WBGene00016111 Length:211 Species:Caenorhabditis elegans


Alignment Length:222 Identity:61/222 - (27%)
Similarity:111/222 - (50%) Gaps:32/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYELETMLRI-----NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVE----RKNAGQSHLSIE 58
            |.|.:|.:.|     |...|.:.||.||:|.::|...:.:|...|:|.|    :|....:.|.:.
 Worm     2 DSENKTSIAIGCKVCNKYKVTKLLGGGSYGCVHEVIELKTGDRYAMKSEYSSMKKPILLNELKVM 66

  Fly    59 STVYN------LLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQ 117
            ..:|.      |....||:..:.:|        ::|::|..:::.:|.:.....::.|.:..:.|
 Worm    67 KAIYTFSSQHVLKVRDMGVHGSTKF--------IIMQMLEKNMDEVFELLGGSMTLNTAVATSYQ 123

  Fly   118 MVDRLEYLHLHHYVHRDIKPENFLM----GVGLTRHRLHLIDFGLSKRYWDMKENRHVPQ-RRGT 177
            .::.||::|...::||||||.|:.:    |.||  ..:::||:|:.||:.|  .|..:.| |:.|
 Worm   124 CLEGLEFMHWAGFLHRDIKPNNYCLDANSGQGL--RTIYIIDYGICKRFVD--NNNVIRQPRKIT 184

  Fly   178 KWAGTARYASVNALCCKVQSRRDDLES 204
            |:.||..:|.:.:...:..||..||||
 Worm   185 KFRGTLDFAPIVSHELREHSRGSDLES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 56/204 (27%)
STKc_CK1 17..279 CDD:270918 56/203 (28%)
C25H3.1NP_001379695.1 PKc_like 18..>211 CDD:419665 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.