DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and C14A4.13

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_496292.1 Gene:C14A4.13 / 182582 WormBaseID:WBGene00007563 Length:471 Species:Caenorhabditis elegans


Alignment Length:302 Identity:89/302 - (29%)
Similarity:142/302 - (47%) Gaps:25/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELETMLRINSIMVIRKLGSGSFGDIYEAKHMGS-GLHVALKVERKNAGQSHLSIESTVYNLLRHG 68
            :|.|::. ...|.::.:|.|::|.:||.....| ....|.|.|.. ...::|..|..:..||:..
 Worm    17 KLSTIIN-GQFMAVQMIGKGAYGVVYEVVRRNSPNTRFACKAELA-IDHNNLKTEWDLMTLLKDN 79

  Fly    69 ------MGIPMTYQFFSNRRHDVLVMELLGPSLETL-FTMCNRRFSMKTVLMLADQMVDRLEYLH 126
                  :|:    :..|.|..:.:||.|:||||..| .|:.|:.|::.|..:.|.|..|.|..:.
 Worm    80 KSKHNIIGV----ELGSERNFNYIVMHLVGPSLSDLRKTVPNKTFTLFTTAVCAIQCFDSLVEIQ 140

  Fly   127 LHHYVHRDIKPENFLMGV-GLTRHRL-HLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVN 189
            ...|:|||:||.||.:|| |....:| :::||||.:..::.::....| |....:.||..|.|:|
 Worm   141 RIGYIHRDVKPSNFAIGVLGSEEEKLVYVLDFGLCRNMFNKQKELRKP-RMKAPFRGTILYCSLN 204

  Fly   190 ALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEF 254
            ........|.||..|:.|::|......|||:    |...:..:...|.||    :.|.|..|.||
 Worm   205 IHQRMEPGRHDDFWSLLYMMIEFHLSDLPWE----NMSKEDTKKAKETKL----DGLLARCPPEF 261

  Fly   255 YNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW 296
            .....|...|.:.:||||..:|.....::.:.|||.|:..||
 Worm   262 RMIRCYLLTLTYSKEPDYVKLREVLCQIMTSKKFTPDMPLDW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 74/252 (29%)
STKc_CK1 17..279 CDD:270918 80/271 (30%)
C14A4.13NP_496292.1 PKc_like 29..286 CDD:389743 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.