DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and B0218.5

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_501367.1 Gene:B0218.5 / 181853 WormBaseID:WBGene00015049 Length:367 Species:Caenorhabditis elegans


Alignment Length:365 Identity:97/365 - (26%)
Similarity:155/365 - (42%) Gaps:60/365 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NDYELETMLRINSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLR 66
            |:.|.:|  :.:...|:..||.|.:|.:|....:......|:|.|...|.:..|.::.   |:|:
 Worm    13 NNEEFKT--KKDRYKVLALLGKGGYGAVYSVLRLSDMEKFAIKCENAAACRKALYMDC---NVLK 72

  Fly    67 HGMGIPMTY------QFFSNRRHDVLVMELLGPSLETL-FTMCNRRFSMKTVLMLADQMVDRLEY 124
            ....|...:      |.....|.:.:||:|:|.:|..| ......||:..|.|..|.|.:..:|.
 Worm    73 GAAKIQSRHFCTVIDQAAVKNRFNFIVMKLIGKNLWDLRMDTAECRFTKGTSLKAASQCLISIEE 137

  Fly   125 LHLHHYVHRDIKPENFLMG--VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYAS 187
            ||...::||||||.||.:|  .....|.:.::||||.:.:....|.|...||..:::.||.|||.
 Worm   138 LHRFGFLHRDIKPGNFAVGRKESNEHHTIFMLDFGLCREFVKRGEGRLRTQRAKSQFRGTTRYAP 202

  Fly   188 VNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLST-----LPNSLC 247
            :|::......|:||:||..|::.....|.|||:    ..|..:.|.:|:.|...     :...|.
 Worm   203 INSMLEIDTGRKDDIESWLYMVAEWTSGGLPWR----KFKATEREKVLKYKKDVRTDKEIMADLF 263

  Fly   248 AGYP-NEFYNYIIYTRQLGFEEEPDYRMIRCTF--LSLLFNLKFTNDLIYDWD------------ 297
            ...| .||...:.|..:|.|..||||:.:.|..  .:....:|.|:.|  |||            
 Worm   264 YNCPLKEFERILKYVDELDFYSEPDYKFVYCCLQHAAAASKIKDTDPL--DWDPNVPYMGPIETI 326

  Fly   298 --------------HAEKNSGKSGSEED------RVVVKK 317
                          ..|.:..|:|.:.:      ||.:||
 Worm   327 GDGKVIELDVDQGMSTEVSFNKTGRDRETADATKRVEIKK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 73/257 (28%)
STKc_CK1 17..279 CDD:270918 81/276 (29%)
B0218.5NP_501367.1 PKc_like 23..297 CDD:389743 81/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.