DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and R13H9.6

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_500716.1 Gene:R13H9.6 / 177277 WormBaseID:WBGene00020072 Length:380 Species:Caenorhabditis elegans


Alignment Length:303 Identity:95/303 - (31%)
Similarity:145/303 - (47%) Gaps:35/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFS-- 79
            ||..||.|.:|.:|....:......|:|.|:..||:..|.::.   |:::....|...:  ||  
 Worm    26 VIALLGKGGYGAVYSVLRLSDMEKFAIKCEKATAGKKVLLMDC---NVMKGATQIKSRH--FSTV 85

  Fly    80 ------NRRHDVLVMELLGPSLETL-FTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKP 137
                  ..|.:.:||:|:|.:|..| ....:.:|:|.|.|..|.|.:..:|:||...|:||||||
 Worm    86 LDRANVKDRFNFIVMKLIGKNLWDLRQDRGDGKFTMGTSLKAASQCLVSIEHLHSFGYLHRDIKP 150

  Fly   138 ENFLMG--VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGT-KWAGTARYASVNALCCKVQSRR 199
            .||..|  .....|.:.::||||.:.|....|.:.:...|.| .:.||.|||.:.::..:.|||:
 Worm   151 GNFAAGRKESNEHHVIFMLDFGLCREYVKRAEGKDLRAARTTAPFRGTTRYAPLASMLQQDQSRK 215

  Fly   200 DDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMK--LSTLPN------SLCAGYPNEFYN 256
            ||:||..|:::....|.|||:.|    |....|.:|:.|  |.|.|:      .||.  ..||..
 Worm   216 DDIESWLYMVVEWTSGGLPWRKL----KAHDREKVLQYKQDLRTKPDILDDFLFLCP--KKEFTR 274

  Fly   257 YIIYTRQLGFEEEPDYRMIR-CTFLSLLFN-LKFTNDLIYDWD 297
            .:.|...||:...|||:.|. |...:...| :|..:.|  |||
 Worm   275 ILKYLDTLGYYAVPDYKFIYFCVQHAANANKIKDADPL--DWD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 81/261 (31%)
STKc_CK1 17..279 CDD:270918 89/282 (32%)
R13H9.6NP_500716.1 PKc_like 23..296 CDD:389743 88/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160878
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.